Protein Info for DvMF_1766 in Desulfovibrio vulgaris Miyazaki F

Annotation: sigma54 specific transcriptional regulator with PAS/PAC sensor, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 PF13188: PAS_8" amino acids 80 to 124 (45 residues), 23.9 bits, see alignment 1.2e-08 PF00989: PAS" amino acids 80 to 207 (128 residues), 31.2 bits, see alignment E=7.8e-11 PF13426: PAS_9" amino acids 88 to 209 (122 residues), 30.6 bits, see alignment E=1.4e-10 PF00158: Sigma54_activat" amino acids 227 to 393 (167 residues), 190.3 bits, see alignment E=8.6e-60 PF14532: Sigma54_activ_2" amino acids 228 to 398 (171 residues), 86 bits, see alignment E=1.2e-27 PF07728: AAA_5" amino acids 250 to 376 (127 residues), 32.9 bits, see alignment E=2.4e-11 PF02954: HTH_8" amino acids 524 to 564 (41 residues), 58.1 bits, see alignment 2.3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1766)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM67 at UniProt or InterPro

Protein Sequence (567 amino acids)

>DvMF_1766 sigma54 specific transcriptional regulator with PAS/PAC sensor, Fis family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MGNGPGCDAAPRTAPPDAGRPVSSPSARHNAQRRNRCFVSTQQTGPAAPHSIRPRAGSPA
RHGAPPLPHVSGISPLPVDLATMLDALPVGVALLDTDCSIRLMNRALETLTGFTTAEVRG
IPCRHALRASICLHRCPLRRPLTTASGVTVATASGAHYDMIDDGELPPAQEGDILNRHRR
RIPVRMSMSPLRDADGRVVGWLHAVEDLTLVRELEEKTAKGEAFGPLVGRSVAMERVFQA
LPAVAQNDGPLLVTGETGTGKDTLAEAVHKASSRAREPFVKASLSSLPEFLAESELFGHR
KGAFPGAEENKPGRFRLAQGGTLYLTEIGDLPLSIQGRLLAFLDEGVIYPVGATEPVACD
VRLVVATNRDPEQLVAEGRLREDLFRRLSAVRLHLPPLRDRGEDIEFLLNHFMGHFAARM
KKTVRGCSGKALRTLLDYPFPGNVRELRNIAEYAVTLCHGETVMPAHLPAYLFQAKAEAR
RAERERRAGRGIPGEPDASGAPGDAQGSAQAAADMAEPLARASVSDLERRLIADALQRTG
NRRGEAAELLGWGRSTLWRKMKQYGMC