Protein Info for DvMF_1739 in Desulfovibrio vulgaris Miyazaki F

Annotation: isocitrate/isopropylmalate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF00180: Iso_dh" amino acids 5 to 378 (374 residues), 313.1 bits, see alignment E=1.4e-97

Best Hits

Swiss-Prot: 53% identical to IDH_ARCFU: Isocitrate dehydrogenase [NADP] (icd) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K00031, isocitrate dehydrogenase [EC: 1.1.1.42] (inferred from 100% identity to dvm:DvMF_1739)

Predicted SEED Role

"Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)" in subsystem TCA Cycle (EC 1.1.1.42)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM40 at UniProt or InterPro

Protein Sequence (382 amino acids)

>DvMF_1739 isocitrate/isopropylmalate dehydrogenase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRKTVYWIEGDGIGPDVWKAARPVIDAAVAKTYGDARSIEWKELLAGEKAYAATGEYLPE
ATMQALRGAELAIKGPLGTPVGKGFRSLNVTLRQTLDLYACIRPIRYFEGIMSPVKRPDL
VDMVVFRENTEDVYAGIEYKAGTPEAKRLIDFLRNELGANVDPESAVGIKPMTARGSKRL
VRRAMDFAVAQKRSSLTLVHKGNIMKFTEGGFREWGYEVVRDEFADAAVLEADAGGAAGK
VVVKDRIADAMFQEVLIRPDQYSVIATSNLNGDYLSDALAAQVGGLGLAPGVNMSDSLAF
FEATHGTAPTIAGQDKANPGSLILCGALMLEHMGWNDAATRIYNAINTTIGKRTVTVDLA
SQMASATTVGTVAFGELVEKAL