Protein Info for DvMF_1730 in Desulfovibrio vulgaris Miyazaki F

Annotation: multi-sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 PF00072: Response_reg" amino acids 29 to 134 (106 residues), 94.7 bits, see alignment E=6e-31 PF08447: PAS_3" amino acids 180 to 255 (76 residues), 43.9 bits, see alignment E=3.6e-15 PF00512: HisKA" amino acids 293 to 345 (53 residues), 29.8 bits, see alignment 7.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1730)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM31 at UniProt or InterPro

Protein Sequence (507 amino acids)

>DvMF_1730 multi-sensor signal transduction histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MCPPPSQPPQSPLFPPPGTAHPHGRPACVLSVEDDPVIRQSIAGWLSDEGYLVLEAEDGI
SALRAVREQRPDVVLLDLGIPGISGDAVLERMAQESPEVPVVVVSGRAEIGDAINAFKLG
AWDYITKPILNMNMLALTVRNCLERRRLRERLSAMESRYSGLVQGLPVVVFSLDDTLELT
FINEACRTVLGWTPEQALLEPGWFMDNVFPEDRERVRGAFSGAFSASTPFSLEFRMINPR
GIPLFVQARSTAVASPDLARGMPGRIEGVLIDLSRRVFLERLLVQREKLNTLGALVDEIA
HEFRNPVFALAGFARTLHRKFPDAQEAEVVLEEATRLEALINRVQQYLAPVDIVPRPCSL
AAVLDFAADLLHAPLQRKGVELRVEAPANLPPVQSDPDLLAQIVVGMAGLAVEHGVPGSE
AVLRCRDAGRGQLVEVLLRTESPLAHDTELSLMPFGDQQGPQPLAVSYKLARDLSCLLHV
RREPDGLLLMLAVPVDPDDVANLLGEE