Protein Info for DvMF_1723 in Desulfovibrio vulgaris Miyazaki F

Annotation: phosphoribosylaminoimidazole carboxylase, catalytic subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00731: AIRC
  • amino acids 3 to 151 (149 residues), 187.8 bits, E=4.1e-60
• TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit
  • amino acids 4 to 160 (157 residues), 176.7 bits, E=1.2e-56

Best Hits

Swiss-Prot: 50% identical to PURE_BRUSU: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 100% identity to dvm:DvMF_1723)

MetaCyc: 50% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis I (5/6 steps found)
• inosine-5'-phosphate biosynthesis III (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

See B8DM25 at UniProt or InterPro

Protein Sequence (166 amino acids)

>DvMF_1723 phosphoribosylaminoimidazole carboxylase, catalytic subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTKVAVFMGSASDEDTVRPCTEVLDSLGISYLFTVSSAHRTPERTEHLVTKLEAEGCQVF
ICAAGMAAHLAGAVAARTQKPVIGIPVAASALGGMDALLATVQMPPGFPVATVALDKAGA
RNAAWLAAQILALADPALSQRLAAARAKMKADAEKAGEELEARYRK