Protein Info for DvMF_1707 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function UPF0118 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 114 to 131 (18 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 166 to 191 (26 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 384 to 414 (31 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 452 to 481 (30 residues), see Phobius details PF01594: AI-2E_transport" amino acids 288 to 488 (201 residues), 107.3 bits, see alignment E=5.5e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1707)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM09 at UniProt or InterPro

Protein Sequence (504 amino acids)

>DvMF_1707 protein of unknown function UPF0118 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSTPARSPRRNARPVLRRAATRLSPSCGGCPGAADALREADGSGSSVSIAPFAPPACAGC
PSARAESAHAAPAGQPEGAATAASSAAGVPSAPSAPPAPSAPSTQAAPGHAAPTRVWLAL
LAVVAVGIGWLLARPFIHTLAVAIVVAALAAPLQERIARRVRQPDLAAASTILTLLLGVA
APLAVFVAALIPQARALARAAMAFYAASGNGGSDAAAGAAAGAATGAVPGAAVAAGSLPA
PVELGLARLHELSVWVTRTLADFGIDAPDLADFDPASLRGTLLGAARQAGETVLHGITAG
VGNAVYLFGHFLLMLFILYFLLRDGRQMMAFVKRVSPLAHAQEDRLLTALRGVARSVFMG
GVLVAVFQGVIGAVGFALVGLPALFWGFAMSFAAMIPVVGTALIWAPATAYLYLSGETWR
AVFLLGWCAVLVSSSDGLLRAWFMKEGAGIPMLYLFLAILGGLNMFGILGLLYGPLLLTF
AMVALTMYAEVAAEIAPKDGGPVR