Protein Info for DvMF_1702 in Desulfovibrio vulgaris Miyazaki F

Name: rpsA
Annotation: 30S ribosomal protein S1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 PF00575: S1" amino acids 34 to 101 (68 residues), 24.9 bits, see alignment E=4.5e-09 amino acids 121 to 187 (67 residues), 38.5 bits, see alignment E=2.6e-13 amino acids 205 to 276 (72 residues), 63.2 bits, see alignment E=5e-21 amino acids 290 to 363 (74 residues), 79 bits, see alignment E=5.7e-26 amino acids 377 to 450 (74 residues), 64.6 bits, see alignment E=1.8e-21 amino acids 466 to 536 (71 residues), 62.1 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 44% identical to RS1_COXBU: 30S ribosomal protein S1 (rpsA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 100% identity to dvm:DvMF_1702)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM04 at UniProt or InterPro

Protein Sequence (577 amino acids)

>DvMF_1702 30S ribosomal protein S1 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTATPENMENAALEMDLSFESALENYLSSDFGDLEEGSIIKGEVVRVDEDSVLVDVNFKS
EGQISASEFRDSTGKVNIAVGDKVDVFVVRKNEMEGTITLSFEKAKRMQLFDKLEEIQEN
NGVITGRIVRRIKGGYTVDLGGVEAFLPGSHVDLRPVPDMDALVNQEYEFRVLKINRRRS
NVIVSRRVLLEEERDSKRQDLLRTLEEGQIVTGKAKNITEYGVFVDLGGLDGLLHITDMS
WKRIRHPKELVTLGQELQLKVLSFDRDNQKVSLGMKQLVADPWQDITAKYPEGAKLQGRV
TNLVDYGAFVELEPGVEGLVHISEMSWTRKLRHPSQMVRVGDEVEVVILGVDQDKKRISL
GMKQVKPNPWEVVAEKYPEGTILEGVIKNITEFGMFIGIEDGIDGLIHVSDISWTKKIRH
PNEVFKTGDVVQAKVLTVDQENEKFTLGIKQLTEDPWTHVPSRYPVGGLIEGTVTNITDF
GLFVEVEEGIEGLVHVSEISQKKIKSPSEMFKEGVVIQAKVIHVSAEERRLGLSIKQLKD
EEERRKPKEFRAGPADTGGQNLGDLLKQKLEEDASDS