Protein Info for DvMF_1699 in Desulfovibrio vulgaris Miyazaki F

Annotation: non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF01725: Ham1p_like" amino acids 19 to 209 (191 residues), 219 bits, see alignment E=2.6e-69 TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family" amino acids 19 to 211 (193 residues), 199 bits, see alignment E=2.3e-63

Best Hits

Swiss-Prot: 70% identical to IXTPA_DESVH: dITP/XTP pyrophosphatase (DVU_3154) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 100% identity to dvm:DvMF_1699)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM01 at UniProt or InterPro

Protein Sequence (219 amino acids)

>DvMF_1699 non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTTVSNTTPANTTGNTAVIVLATRNAGKIRELNDMLHGTGVTVVGLDAYPEIGEIEETGT
TFEENALLKARTVAELTGRIAVADDSGLEVDALGGAPGVYSARYSAEDGVPATDARNNEK
LLAALANVPDAQRTARFRSVIAACAPDGRHITAAGAWEGRVAAAPQGDNGFGYDPLFFDP
ELGRTAATLTRDEKNARSHRGKALRRLLEMWPDFAGGQG