Protein Info for DvMF_1573 in Desulfovibrio vulgaris Miyazaki F

Annotation: Undecaprenyl-phosphate galactose phosphotransferase, WbaP (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 47 to 71 (25 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details TIGR03022: undecaprenyl-phosphate galactose phosphotransferase WbaP" amino acids 17 to 470 (454 residues), 505.1 bits, see alignment E=2.6e-155 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 19 to 470 (452 residues), 365.7 bits, see alignment E=4.4e-113 PF13727: CoA_binding_3" amino acids 66 to 173 (108 residues), 26.3 bits, see alignment E=7e-10 PF02397: Bac_transf" amino acids 273 to 464 (192 residues), 219.6 bits, see alignment E=2.4e-69

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1573)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase( EC:2.7.8.6 )"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DRY2 at UniProt or InterPro

Protein Sequence (470 amino acids)

>DvMF_1573 Undecaprenyl-phosphate galactose phosphotransferase, WbaP (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTLCPVQAAPWRTTLLLILADTAVIICVTLAATLLRDLAGSGIQWGFYPRLLPFLLLLPL
FNAVLGLYAGITLPPPQELKKLTLGASMAFLCAGSFIFFAKGGERYSRMAFLLAWLGCIA
ALPLCRHWLRTRLANRAWWGAPAVILGGGAAAEEVVSTLRQRPLLGLRPVACVPPEGRPD
PSSKGCGLACCASDEEAVRLYPRAYALLLLDSFADSEARHRIVEATARFRNVLIMPPFST
GGARLWVSAMDIGGLLGLLVRQNLLDANRVRLKRAIDLLLTLGSAILVLPLVLAIAAWIR
MDSPGSPFFTQRRIGQHGREMHILKFRTMVQNAECVLHDCLAANPALNAEWERDQKLKCD
PRVTRAGAFLRKTSLDELPQLWNVLRGEMSLVGPRPIVQDEVEKYGEVFDLYTRVKPGIT
GLWQVSGRNDVSYPQRVEMDRYYICNWSVWFDIWILAKTVPVVLHRNGAY