Protein Info for DvMF_1566 in Desulfovibrio vulgaris Miyazaki F

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details PF19528: DUF6056" amino acids 7 to 468 (462 residues), 51.1 bits, see alignment E=4.8e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1566)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DRX5 at UniProt or InterPro

Protein Sequence (624 amino acids)

>DvMF_1566 hypothetical protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRIRWQYSIPLILLFVPFIWAMGFTFPVGDDFARSNEARFWFDIPQALESMGRSWWTWSG
RYTHHFLVIFLGKSAESRFGYALVCSAACLLYWGALWNIFSELSHSKRKAEAFFIASVCM
LALYSCYPTLGISFYEVTDILGITFGNGLVLLFVGRVCALWNAERVRSQDVWISSMPGIL
AVGCYEHSAVATIAVSVCVYVLAARVGHKHKSVFLKIVVVMAGFFLLSFLARGNFRRQTK
RAVSWAQMLEQLLPVFSMTFELLIKFLSSFFAVVCVWLGTVAGGCSDVSAQNGTKVRGFS
PAYVLSGCLLMAFLVTLGIVTVHALSDVPISSTGKLSASVLLLISCVAVAMCVHVLRPVR
CFVVQWMDRGVYILVSAFVIVMVLLMQPAYGDTVYSIFSGETTAYAASKEKRNAYLRWKG
FDAERGVQAVSRELLAPYPNAVWFAIPGSPEEWPASKVAQMFGVDAVAAMLPDPAVALRV
AADRGRLGGLVPIGDGPGGCAAVVERDIVAGPNDTFRFHWLLADVAGCEPGNVVTVVLLH
RQSARPLPVALQRRYERQLLDRERVPVDEMPLFAGIRHSWNFREWTADTGSGPWLAIPVA
APEWGEVKAVFVSVNGSDFRRVPL