Protein Info for DvMF_1553 in Desulfovibrio vulgaris Miyazaki F

Annotation: sulfite reductase, dissimilatory-type alpha subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR02064: sulfite reductase, dissimilatory-type alpha subunit" amino acids 9 to 430 (422 residues), 658 bits, see alignment E=2.5e-202 PF01077: NIR_SIR" amino acids 167 to 396 (230 residues), 124.2 bits, see alignment E=1.7e-40

Best Hits

Swiss-Prot: 90% identical to DSVA_DESVH: Sulfite reductase, dissimilatory-type subunit alpha (dsvA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K11180, sulfite reductase, dissimilatory-type alpha subunit [EC: 1.8.99.3] (inferred from 100% identity to dvm:DvMF_1553)

MetaCyc: 90% identical to dissimilatory sulfite reductase alpha subunit (Desulfovibrio vulgaris)
1.8.1.g [EC: 1.8.1.g]

Predicted SEED Role

"Dissimilatory sulfite reductase, alpha subunit (EC 1.8.99.3)" (EC 1.8.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.3

Use Curated BLAST to search for 1.8.1.g or 1.8.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DRW2 at UniProt or InterPro

Protein Sequence (437 amino acids)

>DvMF_1553 sulfite reductase, dissimilatory-type alpha subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MAKHATPKLDQLESGPWPSFVSDIKQEAAYRAANPKGLDYQIPVDCPEDLLGVLELSYNE
GETHWKHGGIVGVFGYGGGVIGRYCDQPEQFPGVAHFHTVRVNQPAAKYYHTDYLRQLCD
LWDLRGSGLTNMHGSTGDIVLLGTQTPQLEELFFELTHKMNTDLGGSGSNLRTPESCLGM
SRCEYACYDTQACCYALTMEYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDFSVIGTW
KDDIKIDQAAVKAYVGGELKPNAGAHSGRDWGKFDIMAEVVERCPSKCISWNGSALSIKT
SECVRCMHCINTMPRALRIGDERGASILVGAKAPVLDGAQMGSLLVPFVDASEPFDEIKG
VVEKIWDWWMEEGKNRERLGETIKRLSFQKLLEVTEIDPVAQHVKEPRSNPYIFFKEEEV
PGGWDRDITEYRKRHQR