Protein Info for DvMF_1510 in Desulfovibrio vulgaris Miyazaki F

Annotation: two component, sigma54 specific, transcriptional regulator, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF00158: Sigma54_activat" amino acids 150 to 314 (165 residues), 225.1 bits, see alignment E=1.3e-70 PF14532: Sigma54_activ_2" amino acids 151 to 319 (169 residues), 69.5 bits, see alignment E=1.1e-22 PF07728: AAA_5" amino acids 172 to 290 (119 residues), 42.1 bits, see alignment E=2.6e-14 PF00004: AAA" amino acids 172 to 306 (135 residues), 32.6 bits, see alignment E=3e-11 PF02954: HTH_8" amino acids 419 to 454 (36 residues), 25.8 bits, see alignment 2.2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1510)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DLT2 at UniProt or InterPro

Protein Sequence (470 amino acids)

>DvMF_1510 two component, sigma54 specific, transcriptional regulator, Fis family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKYLLAVTPHEDALHVLRTSFSGDVSVIPCRTRAEALAQATGRALDMVMIDLGQLLEGRE
PSRRVLHEAVWEVKRRVPSAEIIVLAEADAVRHAVDAVQAGAGGYLPYPLLEEEVRLVAQ
KLHESALVRSELDYLRDRHWAGDGVDLAHTNSPRMREVFDKVRLVAGTRSTVLLTGETGT
GKSLIARLIHNHSNRRTRRFISVHCGAIPDTLIESELFGHEKGAFTGAVRKKPGKFEIAE
GGTIFLDEIGTVSQSAQIKLLGVLQDRAYQRVGGEAVLRADVRVIAATNEDLAALCAQGR
FRRDLYYRLNVFPVDVPPLRERKEDLLLLAELFVRRYNAQMVKDIRSIHPEVIDAFMGYD
WPGNVRELENLIERACILESGTVLTPDSFPAEFFGPGGGGRLATVDTTLPLAEARRRSVD
VFERAYLERALAQCGGSVQRTAALAGVTTRQLHKLMTRHGLRKEDYKLRG