Protein Info for DvMF_1499 in Desulfovibrio vulgaris Miyazaki F

Annotation: periplasmic binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 51 (51 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 116 to 340 (225 residues), 85.3 bits, see alignment E=2.3e-28

Best Hits

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 100% identity to dvm:DvMF_1499)

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DLS1 at UniProt or InterPro

Protein Sequence (382 amino acids)

>DvMF_1499 periplasmic binding protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTDRMRTFVRQVATTGATTPPHRPCRTLAVALLLLAALAIAFTVPAAAHAGQPAGQSGVH
QSQQPDRRADGGATVRTDGRTDGRTDGQSDRQAGGAVSITDDTGREVRLPHPARRIVALY
GAFNELLAAMDMTDRVAARTAADEEPAAIRSLPVIGTHMRPSPEMVAAVAPDLVLQMEGR
REAGEAVEGLRALGIPVAVFRVGSFGELFGALRRMGTLTGEPQRATALEAALRTRLDAVA
ARVADRPRPAVFFEVRYPNLLAAGADSIVTDIIAHAGGRNCVTAEGRVARLSEEELLRLD
PAVYLLQRGPMNPEPEPPATRPHYATLSAIRNGRVREVDEARYSRPGPRAVDAVEELARY
LHPDVWGTTPATPAADRKQTAP