Protein Info for DvMF_1461 in Desulfovibrio vulgaris Miyazaki F

Annotation: two component, sigma54 specific, transcriptional regulator, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF00072: Response_reg" amino acids 5 to 112 (108 residues), 110.8 bits, see alignment E=1.4e-35 PF00158: Sigma54_activat" amino acids 143 to 308 (166 residues), 246.2 bits, see alignment E=5e-77 PF14532: Sigma54_activ_2" amino acids 144 to 313 (170 residues), 74.5 bits, see alignment E=3.7e-24 PF00004: AAA" amino acids 166 to 284 (119 residues), 23.8 bits, see alignment E=1.8e-08 PF07728: AAA_5" amino acids 166 to 285 (120 residues), 27.5 bits, see alignment E=1e-09 PF02954: HTH_8" amino acids 445 to 485 (41 residues), 36.2 bits, see alignment 1.4e-12

Best Hits

KEGG orthology group: K13599, two-component system, NtrC family, nitrogen regulation response regulator NtrX (inferred from 100% identity to dvm:DvMF_1461)

Predicted SEED Role

"Nitrogen regulation protein NtrX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DLN3 at UniProt or InterPro

Protein Sequence (491 amino acids)

>DvMF_1461 two component, sigma54 specific, transcriptional regulator, Fis family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHARILIIDDEDGIRFSLRGILEDEGFEVLEAPSGEDGLALLARETPDLVFLDIWMPGMD
GLAVLDQLHAQRPDLPVIMISGHGTIETAVNAIRKGAHDFIEKPLSLEKVLIAAQRALEY
GDLRRENEALRDSLPTAHADEMNGRSPVMETLRGQIARVAPTDAWVLITGENGTGKELAA
RAIHAGSRRADRPLVAVNCAAIPEELIESELFGHEKGAFTGADSAKAGKFEMAHKGTLFL
DEIGDMSLKTQAKILRILQEQQFERVGGHRTMRVDVRVIAATNKNLEDEIAAGTFREDLY
YRLRVFPLVLPPLREREGDVPLLIDLFAQRLARDYGVRPATFAPDAQEALARYPWPGNVR
ELRNFVERMLILHAGLEVTRSMLPPEFLPRSGAGMNGSPGAATAAGGRAASGTGGATGQG
GDPLPDHLPDMAALLAPGMDLKAARAAFEAQYLAARLAECGGNVTRLAEAVGIERSHLYR
KLKGYNIQTTD