Protein Info for DvMF_1426 in Desulfovibrio vulgaris Miyazaki F

Annotation: dihydroorotase, multifunctional complex type (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 TIGR00857: dihydroorotase, multifunctional complex type" amino acids 21 to 422 (402 residues), 383.2 bits, see alignment E=8.1e-119 PF01979: Amidohydro_1" amino acids 54 to 422 (369 residues), 68.4 bits, see alignment E=6.8e-23

Best Hits

Swiss-Prot: 45% identical to PYRC_PELCD: Dihydroorotase (pyrC) from Pelobacter carbinolicus (strain DSM 2380 / NBRC 103641 / GraBd1)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 100% identity to dvm:DvMF_1426)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DRT7 at UniProt or InterPro

Protein Sequence (426 amino acids)

>DvMF_1426 dihydroorotase, multifunctional complex type (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTATTSPSLFLRNARLLGRMVDVAVADGRIASVTDAGSGAAPAGAESIDAKGMVLFPAFI
DAHTHMREPGQEYKEDIASGLAAAAHGGFGAVLCMANTRPVNDDASITRDMIDTARRHWP
HGPRLHPIGAATVGLKGTELAPLAELAEAGCVAFSNDGAPVPDTEMFRRCVEYAADQGKV
VIDHCEDPYLAKGAHMNEGETSGRIGVKGQPDIGEALHVARDILLADYLKLPIHLAHISC
RRSVELIAWAKQRGVPVTAETCPHYLLLTDRELLGYDTKAKVNPPLRTDDDVAALRAAVQ
SGVIDILATDHAPHAAHEKETPLDEAPNGITGLDTAVALTWGLVREGVLTEGDLVRLWAA
EPGKIFGLPVNGFNVGDPADFFLLDPEEKWVASRETMHSKSLNTPFLGKELVGRVKALWL
GGVKVV