Protein Info for DvMF_1335 in Desulfovibrio vulgaris Miyazaki F

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF04751: DarP" amino acids 23 to 174 (152 residues), 159.8 bits, see alignment E=2.4e-51

Best Hits

Swiss-Prot: 38% identical to Y5087_PSEA7: UPF0307 protein PSPA7_5087 (PSPA7_5087) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K09889, ribosome-associated protein (inferred from 100% identity to dvm:DvMF_1335)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DRJ7 at UniProt or InterPro

Protein Sequence (179 amino acids)

>DvMF_1335 hypothetical protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MARRRIPDALPPSGVETDNDVRDVSRSQKKRESNAMQTLGQELVRLPASKVRGMGLPDDL
EKAVLEWHAMSTHEARRRQLQYIGRVIREGDWEAVSAQMGEVRAVKQTEDDEFHRIEELR
EQLLAAGPDRLHPYLEQWPDVDPRHLRLLVRDALAERAAGKPPRAGRALFRLLRDVAEE