Protein Info for DvMF_1321 in Desulfovibrio vulgaris Miyazaki F

Annotation: putative GTP cyclohydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF02649: GCHY-1" amino acids 1 to 250 (250 residues), 302.4 bits, see alignment E=1.5e-94

Best Hits

Swiss-Prot: 100% identical to GCH4_DESVM: GTP cyclohydrolase FolE2 (folE2) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K09007, hypothetical protein (inferred from 100% identity to dvm:DvMF_1321)

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DLK8 at UniProt or InterPro

Protein Sequence (259 amino acids)

>DvMF_1321 putative GTP cyclohydrolase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MEDVQNSPAQVAMPIDRVGVKNLKLPLVVRDRAQGSQHTVATVDIGVDLPAEFKGTHMSR
FVEALENWSEELDYNSMKRLLEDVKERLHARKAYALFRFPYFVRKGAPATASSGLVWYEC
RLTGELGDGKPSFLLELEVPVMTVCPCSKAISDEGAHSQRAVVRMSIRMTGFSWMEEFID
LAEAAGSSPVYTLLKREDEKFVTEDAFAHPTFVEDVVRAAAQRLEGHPHVAWFRVEVESF
ESIHCHNAFASIEREVRKG