Protein Info for DvMF_1240 in Desulfovibrio vulgaris Miyazaki F

Annotation: Integral membrane protein TerC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 5 to 304 (300 residues), 402.4 bits, see alignment E=7e-125 PF03741: TerC" amino acids 69 to 271 (203 residues), 177.3 bits, see alignment E=1.3e-56

Best Hits

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 100% identity to dvm:DvMF_1240)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DLC8 at UniProt or InterPro

Protein Sequence (338 amino acids)

>DvMF_1240 Integral membrane protein TerC (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSGYMLWGGFNLFVLVLLAFDLGVLHRKDKEMSLSGALWMSLAYFALALAFGGGVFMFMG
EQKGLEYITGYLIEKSLSVDNIFVFVLVFTHFAVPAALQYRVLFWGILGALAMRAGLILA
GAAILNAFHWVIYVFGGFLVITGIKMLLAADSEPDLSGNRVVRLFRRHFRLTEGYEGGHF
VVRKNGLLHATPLLVVLVIIEFSDLVFALDSIPAIFAVSTDPFIVYTSNVFAILGLRALY
FALAGVIHRFRYLKYGLSLVLVFIGAKMIVNAAFDAKIISTGAALLVTFGIIAGSMLISM
AKTRGAGADAQAAPPLGWVPGTPSKSERTTDNTGKPPR