Protein Info for DvMF_1114 in Desulfovibrio vulgaris Miyazaki F

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 135 to 153 (19 residues), see Phobius details amino acids 301 to 325 (25 residues), see Phobius details PF08376: NIT" amino acids 47 to 286 (240 residues), 195.2 bits, see alignment E=3.7e-61 PF00672: HAMP" amino acids 325 to 372 (48 residues), 33.6 bits, see alignment 6.2e-12 PF00015: MCPsignal" amino acids 478 to 662 (185 residues), 162.4 bits, see alignment E=1.5e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1114)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKA6 at UniProt or InterPro

Protein Sequence (700 amino acids)

>DvMF_1114 methyl-accepting chemotaxis sensory transducer (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKVLAIMLLPLVALLAFSGSLVMGKRAIVVEMQEVERLAALSVTIGDVVHELQKERGLSS
GFLASRGERFGPEMVAQRRGSDSALDRLHARLRVFREENLPLETKAALAKVESGLGGIGG
KRREVDALELKPAGIIAAYSATIAALLDVNAVISRASSEPRVLGRIVAYDSLLWAKEYAG
RERATLNGVFAQGTLSGDLFRSWLTVLAAQDERLAAFKALAAPEAAALLEERLTGPAVAD
VARMRALVMTGTQGEALEGDAAEWFKASTARIELLRQVEVGLGDALMQLANRLGQDARWD
MLVYVSLAGAALAVTLAVGLLVFVSINAPLRRAVAFAEAVGKGNLDHPLDVRQADEIGTL
CNAMTSMVGNLKLKIAEAQTQTQLAAQETEHARTAQAEADEARAEAERARRNGMLQASVR
MEGMVRKLSGASEGIAAQVVQSSRGAQAQKDRVAGTALAMEQTNDAVMDVARSAGRASEI
SHEARQLASDGAGVVRRLVGMVGDVRVQALQLKGDMEILGTNAANIGQVLGVINDIADQT
NLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMTATKEVAEAVVGIQSATRSNAESV
SQTVGSIENATGMAEESARSLERIVDMVTHASDQVRSIAAAAEQQSAASKEISDSLADIN
SIANDTAKGMEHSTLAVEELASLARALQQMVTEMAAEGRA