Protein Info for DvMF_0968 in Desulfovibrio vulgaris Miyazaki F

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 224 to 245 (22 residues), see Phobius details PF12917: YfbR-like" amino acids 200 to 302 (103 residues), 43.5 bits, see alignment E=3e-15 PF13023: HD_3" amino acids 204 to 400 (197 residues), 101.5 bits, see alignment E=4.7e-33

Best Hits

KEGG orthology group: K07023, putative hydrolases of HD superfamily (inferred from 100% identity to dvm:DvMF_0968)

Predicted SEED Role

"Competence protein ComGF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPL6 at UniProt or InterPro

Protein Sequence (423 amino acids)

>DvMF_0968 hypothetical protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPSIRKSLLQFVFSGAYMKRWNDKLRPVELLEVDKQAHKMIVAWLLLQLNTRGLPAEERL
RLGAEVVEGGLFDYFYRLVITDIKPPVFYRIKENEAHYSELTEWVAEELEHIVRPLDEDF
WQRLLTYIRRREKNTLADRILTAAHLYASGWEFNLIKPLNTFDDEMPDIDGSFQTRLTAM
ADLAGVPELIGGSSNALGRFANLCGQLRFQKRWSQTPRIPETSVIGHMFIVACYAYFFSI
AVGACPARRLNNFFCGLFHDLPEVLTRDIISPVKRSVKQLPELIRQYEEQEMQERVFALL
DKAGYGDVANRLGYFLGLATGSEFDETVREPAPAEAPDGTAPVVRKVTFDELQSTCNIDA
LDPKDGRLVKACDTLAAFIEAHTSVRNGVTSSHLQEAIARLRGEYRRVSLGPLHVGALFA
DFD