Protein Info for DvMF_0959 in Desulfovibrio vulgaris Miyazaki F

Name: mraY
Annotation: phospho-N-acetylmuramoyl-pentapeptide- transferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 133 to 149 (17 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 236 to 253 (18 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details TIGR00445: phospho-N-acetylmuramoyl-pentapeptide-transferase" amino acids 37 to 358 (322 residues), 417.7 bits, see alignment E=1.9e-129 PF10555: MraY_sig1" amino acids 67 to 78 (12 residues), 23.4 bits, see alignment (E = 2.9e-09) PF00953: Glycos_transf_4" amino acids 99 to 281 (183 residues), 117.9 bits, see alignment E=4.5e-38

Best Hits

Swiss-Prot: 84% identical to MRAY_DESVV: Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K01000, phospho-N-acetylmuramoyl-pentapeptide-transferase [EC: 2.7.8.13] (inferred from 100% identity to dvm:DvMF_0959)

MetaCyc: 53% identical to phospho-N-acetylmuramoyl-pentapeptide-transferase (Escherichia coli K-12 substr. MG1655)
Phospho-N-acetylmuramoyl-pentapeptide-transferase. [EC: 2.7.8.13]

Predicted SEED Role

"Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)" in subsystem Peptidoglycan Biosynthesis (EC 2.7.8.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DP82 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DvMF_0959 phospho-N-acetylmuramoyl-pentapeptide- transferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MLYNLLYPLSSEFTVLNVFRYITFRSVWALLTALLLSILMGPRFIAWLQRIKCGQHIHED
VTCHMQKAGTPTMGGLLIAFCLTCSVLLWADLTNKYVWLTMLIFLGFGLVGFLDDYIKIR
RRNNKGLSARAKFLGQVIVAAVAMYMVVSEPVYSTRLAFPFFKGLAPDLGWLYIPFAVTV
MVGSSNGVNLTDGLDGLAIGPTIIAGMVFAVFIYVAGNVQMATYLQVPNVPGVGEVTVFC
GALVGASLGFLWFNAYPAQVFMGDVGSLALGGALGFLAVLCKQELLLLVVGGLFVVETLS
VILQVGYFKFTGGKRIFRMAPLHHHFELQGIPESKIIIRFWIMSALLGLMALSVLKLR