Protein Info for DvMF_0937 in Desulfovibrio vulgaris Miyazaki F

Annotation: ferredoxin-NADP(+) reductase subunit alpha (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00175: NAD_binding_1
  • amino acids 106 to 199 (94 residues), 27.3 bits, E=5e-10
• PF10418: DHODB_Fe-S_bind
  • amino acids 214 to 251 (38 residues), 50.3 bits, 1.6e-17

Best Hits

Swiss-Prot: 54% identical to SUDHB_PYRFU: Sulfide dehydrogenase subunit beta (sudB) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: K00528, ferredoxin--NADP+ reductase [EC: 1.18.1.2] (inferred from 100% identity to dvm:DvMF_0937)

Predicted SEED Role

"Dihydroorotate dehydrogenase electron transfer subunit (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

• UMP biosynthesis II (6/6 steps found)
• NADPH to cytochrome c oxidase via plastocyanin (thylakoid membrane) (2/4 steps found)
• photosynthesis light reactions (1/4 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (13/26 steps found)

KEGG Metabolic Maps

• Photosynthesis
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.3.3.1

Use Curated BLAST to search for 1.18.1.2 or 1.3.3.1

Sequence Analysis Tools

See B8DP60 at UniProt or InterPro

Protein Sequence (282 amino acids)

>DvMF_0937 ferredoxin-NADP(+) reductase subunit alpha (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPCKILEKERLIPGQTSKLVIDAPHIAKKALPGNFVILRVCEKGERIPLTIADADPERGT
ITIVYLVMGKSTALLETLDAGDSILDLCGPLGKATHIEKAGTVICVGGGTGIAAMHHIAK
GHHKAGNHVVAVIGARSKDLLLFYDELSSFCPEVLVSTDDGSFGHKGLVTDLLRQRLETD
KTVSEVVAVGPVPMMAAVAKTTEPFGVKTTVSLNSIMVDGIGMCGACRVSVGGETRFACV
DGPEFDGHKVDFNELRQRLAAFKPQEKASYDHHCKCTCAGEK