Protein Info for DvMF_0937 in Desulfovibrio vulgaris Miyazaki F

Annotation: ferredoxin-NADP(+) reductase subunit alpha (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF00175: NAD_binding_1" amino acids 106 to 199 (94 residues), 27.3 bits, see alignment E=5e-10 PF10418: DHODB_Fe-S_bind" amino acids 214 to 251 (38 residues), 50.3 bits, see alignment 1.6e-17

Best Hits

Swiss-Prot: 54% identical to SUDHB_PYRFU: Sulfide dehydrogenase subunit beta (sudB) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: K00528, ferredoxin--NADP+ reductase [EC: 1.18.1.2] (inferred from 100% identity to dvm:DvMF_0937)

Predicted SEED Role

"Dihydroorotate dehydrogenase electron transfer subunit (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.3.1

Use Curated BLAST to search for 1.18.1.2 or 1.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DP60 at UniProt or InterPro

Protein Sequence (282 amino acids)

>DvMF_0937 ferredoxin-NADP(+) reductase subunit alpha (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPCKILEKERLIPGQTSKLVIDAPHIAKKALPGNFVILRVCEKGERIPLTIADADPERGT
ITIVYLVMGKSTALLETLDAGDSILDLCGPLGKATHIEKAGTVICVGGGTGIAAMHHIAK
GHHKAGNHVVAVIGARSKDLLLFYDELSSFCPEVLVSTDDGSFGHKGLVTDLLRQRLETD
KTVSEVVAVGPVPMMAAVAKTTEPFGVKTTVSLNSIMVDGIGMCGACRVSVGGETRFACV
DGPEFDGHKVDFNELRQRLAAFKPQEKASYDHHCKCTCAGEK