Protein Info for DvMF_0909 in Desulfovibrio vulgaris Miyazaki F

Annotation: cytidylate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02224: Cytidylate_kin
  • amino acids 2 to 213 (212 residues), 199.2 bits, E=1.4e-62
• TIGR00017: cytidylate kinase
  • amino acids 2 to 207 (206 residues), 191.9 bits, E=5.8e-61
• PF13189: Cytidylate_kin2
  • amino acids 2 to 175 (174 residues), 29 bits, E=2.3e-10

Best Hits

Swiss-Prot: 70% identical to KCY_DESVH: Cytidylate kinase (cmk) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00945, cytidylate kinase [EC: 2.7.4.14] (inferred from 100% identity to dvm:DvMF_0909)

Predicted SEED Role

"Cytidylate kinase (EC 2.7.4.25)" (EC 2.7.4.25)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• CMP phosphorylation (2/2 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (4/9 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.25

Sequence Analysis Tools

See B8DP32 at UniProt or InterPro

Protein Sequence (219 amino acids)

>DvMF_0909 cytidylate kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MVTLDGPAGVGKTTLAKRLADALGVAYLDTGAMFRTLAWKLGPGAHELPEGDLRARLEGF
CFALSGAGGASVLSCNGVPVGEEIRTEEVAALASRIATLPVVRERLKAAQQALGASCALV
VEGRDMGTVVFPTARHKFFLDATPEERARRRCQQLEAQGQPADLATIAAQIRERDDMDRN
RAVAPLRAADDAETVDTTTLDIDGVFAELTRHITARGGL