Protein Info for DvMF_0898 in Desulfovibrio vulgaris Miyazaki F

Annotation: pyridine nucleotide-disulphide oxidoreductase dimerisation region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00890: FAD_binding_2
  • amino acids 10 to 45 (36 residues), 27.9 bits, 5.8e-10
• PF07992: Pyr_redox_2
  • amino acids 10 to 354 (345 residues), 205.8 bits, E=4.1e-64
• PF12831: FAD_oxidored
  • amino acids 10 to 51 (42 residues), 37.2 bits, 9.4e-13
• PF01134: GIDA
  • amino acids 10 to 65 (56 residues), 26 bits, 1.9e-09
• PF13450: NAD_binding_8
  • amino acids 13 to 47 (35 residues), 24.8 bits, 8.8e-09
• PF00070: Pyr_redox
  • amino acids 178 to 243 (66 residues), 56.3 bits, E=1.5e-18
• PF02852: Pyr_redox_dim
  • amino acids 374 to 479 (106 residues), 91.5 bits, E=1.6e-29

Best Hits

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 100% identity to dvm:DvMF_0898)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• phenylmercury acetate degradation (1/2 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (15/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (1/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (1/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.16.1.1 or 1.8.1.4

Sequence Analysis Tools

See B8DP21 at UniProt or InterPro

Protein Sequence (508 amino acids)

>DvMF_0898 pyridine nucleotide-disulphide oxidoreductase dimerisation region (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MARTPRHDADLLVIGGGAAGLTAAAGAARFGARVVLAEREPALGGDCLHHGCVPSKTLLA
TARARHVMRRAALFGLPAPELEPVDFAAVARRIREVQAVIQRHDSPQRFTGLGVDVRFGP
ARFCDEHTVEIGGRRVSAARILIATGSSPQLPPLPGLDTVPFLTNRDIFSLDALPASLLV
LGGGPMACEMAQAFARLGSRVTMVLRGPRILPRDDADMAGVVHASLAADGVRVLAGATVK
MLRAVSAISGRFGKPGEPVGADGNDAAGTGVEAELEVPQGEGRGPLVVRADRLLAALGRT
PETAGLDLAAAGVATGRHGGITVDGRMRTSQPHVFAAGDVTGDWQFTHAAGHEAGVVVAN
AVLRLPRRADHARMPWCTFTDPELASVGCNERMAAERGLPVDVHVEPFAANDRALAEGTP
EGRLKLVLRKGGNRVLGVQAVGPHAGEVLNEWVAVLGGGVRLSALAGAVHPYPTLGEISA
RAAGNVVSRVLFSVGARRLLRLLFGYRG