Protein Info for DvMF_0840 in Desulfovibrio vulgaris Miyazaki F

Annotation: glycogen branching enzyme (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 TIGR01515: 1,4-alpha-glucan branching enzyme" amino acids 13 to 640 (628 residues), 845.7 bits, see alignment E=1.1e-258 PF22019: GlgB_N" amino acids 18 to 100 (83 residues), 27.1 bits, see alignment E=7.3e-10 PF02922: CBM_48" amino acids 29 to 114 (86 residues), 65 bits, see alignment E=1.3e-21 PF00128: Alpha-amylase" amino acids 191 to 259 (69 residues), 38.7 bits, see alignment E=1.5e-13 amino acids 292 to 513 (222 residues), 28.8 bits, see alignment E=1.5e-10 PF02806: Alpha-amylase_C" amino acids 543 to 641 (99 residues), 71.7 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 76% identical to GLGB_DESVV: 1,4-alpha-glucan branching enzyme GlgB (glgB) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K00700, 1,4-alpha-glucan branching enzyme [EC: 2.4.1.18] (inferred from 100% identity to dvm:DvMF_0840)

Predicted SEED Role

"1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC 2.4.1.18)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 2.4.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.18

Use Curated BLAST to search for 2.4.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DL93 at UniProt or InterPro

Protein Sequence (643 amino acids)

>DvMF_0840 glycogen branching enzyme (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MQLTYPAFIEPFDLYMFGKGEHWDLYRVLGAHPVAQDGAEGYRVAVWAPSAREVYLVGDF
NDWRWGEYPLYPVGVSGVWAAFVPGMRKGALYKFGIRTGEAGDGRIVYKTDPFALYAEMR
PGVAAVAWDIDNHQWADGDWMQCRAEAGPPLRQAVSIYEVHAGSWQRKTDGTGVGGHPFL
SWDELGDGLIPHVQNLGFTHIELLPVAEHPLDQSWGYQTGHYYAPTSRHGTPEDFKRFVD
RCHQAGIGVILDWVPAHFPKDDWSLGRFDGTALYEHLDPRRGEHPDWGTFIFNYGRHEVR
NFLLANALYWLREFHIDGLRMDAVASMLYLDYSREGGDWLPNDHGGRENLDAVEFLRQLN
VVVHGQFPGAMTIAEESTAWAGVSRPVYTGGLGFTFKWNMGWMHDTLNYFRHEPVHRAYH
HNALTFSLLYAFTENFVLPLSHDEVVHGKGALLSKMPGDAWQQQASLRALYAYMWAHPGK
KLLFMGGEFGQWNEWDESGALDWCLYQFPAHGGIHALLRDLNSILRREPAMHAHDHDWTG
FRWMDFSDWGGSVISFVRQCPDGEGAPPVLWVFNFTPVVREYYRVPAPRGGTWRVVLNTD
SEYYGGSNVGNGGALQARTDEWGGGHHLVLTLPPLAGLALMPG