Protein Info for DvMF_0822 in Desulfovibrio vulgaris Miyazaki F

Annotation: GTP-binding protein TypA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 PF00009: GTP_EFTU" amino acids 9 to 198 (190 residues), 185.5 bits, see alignment E=1.9e-58 TIGR00231: small GTP-binding protein domain" amino acids 10 to 147 (138 residues), 83.4 bits, see alignment E=1.6e-27 TIGR01394: GTP-binding protein TypA/BipA" amino acids 10 to 601 (592 residues), 891.2 bits, see alignment E=2.7e-272 PF01926: MMR_HSR1" amino acids 13 to 134 (122 residues), 24.8 bits, see alignment E=5e-09 PF03144: GTP_EFTU_D2" amino acids 224 to 294 (71 residues), 39.7 bits, see alignment E=1.3e-13 PF00679: EFG_C" amino acids 402 to 485 (84 residues), 80.5 bits, see alignment E=1.9e-26 PF21018: BipA_C" amino acids 489 to 597 (109 residues), 150.2 bits, see alignment E=4.2e-48

Best Hits

Swiss-Prot: 51% identical to TYPA_BACSU: GTP-binding protein TypA/BipA homolog (typA) from Bacillus subtilis (strain 168)

KEGG orthology group: K06207, GTP-binding protein (inferred from 100% identity to dvm:DvMF_0822)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DL75 at UniProt or InterPro

Protein Sequence (612 amino acids)

>DvMF_0822 GTP-binding protein TypA (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSTAVHNDRLRNVAIIAHVDHGKTTLVDALFRQSGVFRADQQMDDRVMDRMDLERERGIT
IAAKNCAVSWQGVKINIIDTPGHADFGGEVERALSMASGAILLVDASEGPLPQTRFVLRK
TLEAGLKVVVVVNKIDRKDARPQEVLNEIYDLFIDLDANEQQLEFPVLYAIGREGVAMHG
LEDEQVDLSPLFETIVKEMPGPMYDPAEPFQMLVADLAYSDYLGRMAVGRVFHGSVKAKD
SLVCIDEDGKENPLRVTRLQVYEGLQLRDADEADPGDIVVVAGIENVKIGDTICTREAPR
ALPRIRVDEPTVAMRFTINTSPLAGREGKLVQSSKIRERLLREALSNVAIRVEDSEERDS
FIVKGRGEFQMAILIETMRREGFELCVGRPEVIMREKDGERLEPIEHLYVDCDEVFMGVV
TEKLSIRKGRMTNCANNGTGRVRLEFSVPSRGLIGYRDEFLTDTKGTGIMNSYLEGYEPY
RGDFPTRFTGSLVSDRSGNAVAYALFNLEPRGEMFCVPGDPVYEGLICGEHNRENDIDVN
PTKEKKLTNMRASGKDENVILTPVRPMTLERALHFVREDEMVEVTPLSIRLRKTILAAQK
RYQMEAAKKKGK