Protein Info for DvMF_0779 in Desulfovibrio vulgaris Miyazaki F

Annotation: PBS lyase HEAT domain protein repeat-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 PF13646: HEAT_2" amino acids 5 to 87 (83 residues), 30.8 bits, see alignment E=8.8e-11 amino acids 97 to 168 (72 residues), 33.4 bits, see alignment E=1.3e-11 amino acids 169 to 240 (72 residues), 37.8 bits, see alignment E=5.8e-13 amino acids 423 to 504 (82 residues), 42.6 bits, see alignment E=1.9e-14 amino acids 517 to 586 (70 residues), 51.7 bits, see alignment E=2.7e-17 amino acids 547 to 629 (83 residues), 61.2 bits, see alignment E=2.9e-20 PF02985: HEAT" amino acids 545 to 571 (27 residues), 19.3 bits, see alignment (E = 2.9e-07) PF03130: HEAT_PBS" amino acids 560 to 583 (24 residues), 19.5 bits, see alignment (E = 3.2e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0779)

Predicted SEED Role

"COG1413: FOG: HEAT repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DL33 at UniProt or InterPro

Protein Sequence (641 amino acids)

>DvMF_0779 PBS lyase HEAT domain protein repeat-containing protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSEQQIIEQLQGDDVEAIREAAYAAGNLRLESAVPHLVARIQSHNIGVQEAADRALRKIG
GVAAVHGVLPLLRSDDAPIRNIAMDVLREIGADDFDSLKQLLHDDDPDMRIFASDILGTS
ESILAVPSLCEALLRDPEVNVRYQAAVSLGTLAFPEAADCLNKAMMDEEWVQFSVIEALT
KIRAESSVNALVKALDSASDLVASMIVDALGEMGNIKAVPLLLKRLDKSPGPLRNKIAKA
IVNVLGGKSLSLLGEKDRLRLRDYLLAAMDDEDEDVQNAAMRGLASIGGAEATEAVLKVA
VVLDPDRDHERLVACVQSLADIGFNSAVDRHVRGDDEHTLLILVEAIRGMPSRHGIDVLR
GVFWDKPRDAQRAMSTVLAERCDPSDRDFFIDVLDRHNDAHVLKAALHYLGRRAKAVEAG
DRMLALLEHPYDDVKEAALDACIALNNPAMNARFRESFRSPDPLHRMMAVYAMGRFDVEE
NLAELTEALEDEVPDVRKVALEAVANVCPFSSSRLELVVPRLHDENREVRLALIELLGNC
GEGNVFPYLIQALDDPDDWVRVRAIEALGTLKDAEAVPQLVALTESAGHLVLLKVVEALG
AIGGNVAFRALLHLMESDDPEVQQAAETAAARIHEEQGVDD