Protein Info for DvMF_0722 in Desulfovibrio vulgaris Miyazaki F

Annotation: phage-related membrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details PF13272: Holin_2-3" amino acids 16 to 123 (108 residues), 105.8 bits, see alignment E=7.2e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0722)

Predicted SEED Role

"phage-related membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKX6 at UniProt or InterPro

Protein Sequence (123 amino acids)

>DvMF_0722 phage-related membrane protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSILSRLRGIRHARMLLCSLIAVALWLFLWHASPREALIVTYKVTLVMLAAVAAYWIDRW
LFPYARPEGYLCEEWRDRIGSGDWPDGVDDFPVVTESKTLFMVACLRRVVLMGAAMLAVG
LGL