Protein Info for DvMF_0699 in Desulfovibrio vulgaris Miyazaki F

Annotation: putative two component, sigma54 specific, transcriptional regulator, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF00158: Sigma54_activat" amino acids 133 to 299 (167 residues), 206.5 bits, see alignment E=4.7e-65 PF14532: Sigma54_activ_2" amino acids 139 to 304 (166 residues), 66.4 bits, see alignment E=6.5e-22 PF07728: AAA_5" amino acids 156 to 275 (120 residues), 38.2 bits, see alignment E=2.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0699)

Predicted SEED Role

"sigma-54 interaction domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DK60 at UniProt or InterPro

Protein Sequence (489 amino acids)

>DvMF_0699 putative two component, sigma54 specific, transcriptional regulator, Fis family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MASILMIGYQADLYAHLSRMLVREGHTLHLASSLDEGVEYCDSSRCCLVVLEEGVVPVMS
VAISTLRSTAASPHVVVVSERYDAGFGQDAILGGALNYMQKGTAPRAICALISHLPGISA
DENHISSFREFGIYGSSAKLQVQLSIISRSRSADVNVLLQGETGTGKELFAKAIHRMSPR
KDGPLITVDCASLPEHLVESLLLGYSQGAFTGAARSRVGLIKQADGGTLFLDEVGELPLA
LQKKFLRVLHERRYRPVGGGKEETSNFRLVAATNRDLQEMVGLGTFRDDLLYRISTMKVL
LPPLRERGADVIEIAEHLLEARAAANGGSPRQMSADFKARLLAYPWPGNIRELVNVIDCT
LAVATDGDVLFAEHLPATIHAGMLQASNHAWSGPRQGAAHRRDGMAQGPAVVDDDARLHS
GEDIAISISRPHVIPSFREAKREAMESFERTYLSKLYAEVQGNVQNACALSNLSRARLYE
LMRKYDMLS