Protein Info for DvMF_0604 in Desulfovibrio vulgaris Miyazaki F

Annotation: 2-oxoglutarate ferredoxin oxidoreductase subunit beta (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 46% identical to KORB_METTM: 2-oxoglutarate synthase subunit KorB (korB) from Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)

KEGG orthology group: K00175, 2-oxoglutarate ferredoxin oxidoreductase subunit beta [EC: 1.2.7.3] (inferred from 100% identity to dvm:DvMF_0604)

MetaCyc: 43% identical to 2-oxoglutarate ferredoxin oxidoreductase beta subunit (Methanococcus maripaludis)
2-oxoglutarate synthase. [EC: 1.2.7.3]

Predicted SEED Role

"2-oxoglutarate oxidoreductase, beta subunit (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

reductive TCA cycle I (9/11 steps found)
incomplete reductive TCA cycle (6/7 steps found)
TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
TCA cycle VI (Helicobacter) (7/9 steps found)
TCA cycle VII (acetate-producers) (6/9 steps found)
reductive TCA cycle II (7/12 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJW5 at UniProt or InterPro

Protein Sequence (277 amino acids)

>DvMF_0604 2-oxoglutarate ferredoxin oxidoreductase subunit beta (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MADVTQLIHDYLRHNKKFPHVFCAGCGHGIVLGSLIRSVHALGLPKDDVVLVAGIGCSGR
MAVYVDFNTVHTTHGRALTFATGIKMANPKLKVICVMGDGDALSIGGNHLIHAARRNIGV
TALILNNQIYGMTGGQCSSATPQGDISMTTPFGSLEKAFDIADMCKAAGASYVARGTSFH
AIQLDRLISSAIMHPGFSVVEVFSPCPTQYGRKNKFRNAVDMYKWLKSNTVKVETLKDPD
QKPADGRIPIGVFRDVEEPGLEERYFELQRKLMGQNR