Protein Info for DvMF_0597 in Desulfovibrio vulgaris Miyazaki F

Annotation: phosphonate ABC transporter, ATPase subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR02315: phosphonate ABC transporter, ATP-binding protein" amino acids 23 to 264 (242 residues), 320.6 bits, see alignment E=3.2e-100 PF00005: ABC_tran" amino acids 39 to 195 (157 residues), 129 bits, see alignment E=2e-41

Best Hits

Swiss-Prot: 82% identical to PHNC_DESVH: Phosphonates import ATP-binding protein PhnC (phnC) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 100% identity to dvm:DvMF_0597)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJV8 at UniProt or InterPro

Protein Sequence (270 amino acids)

>DvMF_0597 phosphonate ABC transporter, ATPase subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHKATESASTSRRPACSAGDKSLVVENLRKEYTRGKPVLKNINLTVAGQCTTAIIGPSGT
GKSTLLRCINRLIEPTSGRILVSGQDICTLRGSDLRAARRRIGMVFQEYNLVERLSVMEN
VLCGRLGYISPWRAWLRKFPQEDIERAYDLLDMVGLTEFARARADELSGGQRQRVGIARA
VMQQPHILLADEPTSSLDPKTSVEIMELLREVASVNDIPVLVNIHDVTLGRRFADRVVGM
SKGDVVFDGVPGDLTDEHLKLIYGGEDWLA