Protein Info for DvMF_0546 in Desulfovibrio vulgaris Miyazaki F

Annotation: Glutamate synthase (NADPH) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 PF12838: Fer4_7" amino acids 21 to 66 (46 residues), 30.7 bits, see alignment 1.8e-10 PF00037: Fer4" amino acids 46 to 69 (24 residues), 21.9 bits, see alignment (E = 5.8e-08) PF01645: Glu_synthase" amino acids 111 to 474 (364 residues), 451 bits, see alignment E=1.8e-138 PF00478: IMPDH" amino acids 296 to 412 (117 residues), 26.3 bits, see alignment E=1.8e-09 PF04898: Glu_syn_central" amino acids 326 to 483 (158 residues), 30.9 bits, see alignment E=9.8e-11 PF01070: FMN_dh" amino acids 379 to 418 (40 residues), 27.3 bits, see alignment 9.2e-10

Best Hits

Swiss-Prot: 63% identical to AGLUS_THEMA: Archaeal-type glutamate synthase [NADPH] (gltB) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0546)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKS4 at UniProt or InterPro

Protein Sequence (507 amino acids)

>DvMF_0546 Glutamate synthase (NADPH) (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHVKPISQHFNDFVIERERARCINCEVCVRQCSYEAHFWDEARQFVVHDSARCVGCHRCA
AMCPTSCLTIRKKPSDFRDNSLWTSTYIKHIFKQADTGGVLLSGMGNPQPKPIYWDNMLL
DASQVTNPSIDPLREPMELRTFLGAKPDAVDFIHTPEGPRLKQPLPPQLQLEYPIMFAAM
SFGAINFNLHVAMARAATQLGICYNTGEGGLHPDLYQYGANTIVQVASGRFGVHKDYLNA
GAAVEIKVGQGAKPGIGGHLPGEKIDEEVSRTRMVPQGSDAISPAPHHDIYSIEDLLQLI
YAIKESTRYRVPVAVKIAAVHNAPAIASGIVRAGADIVVIDGFRGGTGAAPTMIRDNVGI
PIELALASVDNRLRDEGIRNHASLVVAGGVRCSADVVKAIALGADAVYIGTAALVAVGCT
LCGRCYTGKCPWGIATNAAQLKKRQNPDVAAQRMANLVRAWGHEIQEMLGGMGLNSIESL
RGNRDKLRGVGLNDVELGVLGIKHAGL