Protein Info for DvMF_0539 in Desulfovibrio vulgaris Miyazaki F

Annotation: cytochrome c class I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00034: Cytochrom_C" amino acids 29 to 107 (79 residues), 40.9 bits, see alignment E=2e-14

Best Hits

Swiss-Prot: 54% identical to CY553_DESVH: Cytochrome c-553 (cyf) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0539)

Predicted SEED Role

"Cytochrome C553 (soluble cytochrome f)" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKR7 at UniProt or InterPro

Protein Sequence (108 amino acids)

>DvMF_0539 cytochrome c class I (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKTSMVATALGALLACTMWIPVAVSHAVAADGAGLYAQCAGCHGEDGGKAALGAARPVKG
QTVDALYGKLKGYADGSYGGSKKAVMAGIAKKLSDEDMRALAAHIASF