Protein Info for DvMF_0533 in Desulfovibrio vulgaris Miyazaki F

Annotation: cytochrome c oxidase, subunit II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 14 to 39 (26 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details TIGR02866: cytochrome c oxidase, subunit II" amino acids 9 to 197 (189 residues), 187.3 bits, see alignment E=1.2e-59 PF02790: COX2_TM" amino acids 16 to 73 (58 residues), 28.9 bits, see alignment E=2.2e-10 PF00116: COX2" amino acids 115 to 187 (73 residues), 59.4 bits, see alignment E=6.5e-20 PF00034: Cytochrom_C" amino acids 306 to 400 (95 residues), 39.8 bits, see alignment E=1.9e-13 PF13442: Cytochrome_CBB3" amino acids 306 to 397 (92 residues), 22.7 bits, see alignment E=2.1e-08

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to dvm:DvMF_0533)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKR1 at UniProt or InterPro

Protein Sequence (405 amino acids)

>DvMF_0533 cytochrome c oxidase, subunit II (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MYPQSLTPVQQVDLAFTIIFGFSVFVLLAITAAMLWFVWRYHESRHPVPAQFSGNVPAEI
AWTVIPSIIVMGLFYYGWEGYKALRTVPKDAMEVKVTARMWSWVFEYPGGKRGSVLVVPV
DTPVKLNMTSTDVIHSLYVPAFRIKMDTVPGMETYAWFKADRPGEYDLLCAEYCGLKHAN
MITTVKVVDKPAFDAWLASTEAPGGKGRALLETYGCSSCHSLDGTPGVGPTFKDLYGAER
EVALPDGTKRKVVADEGYLRRAFTDPNGEVVAGYDPIMPSTEGMVPNEDMEQMLAWLMHG
NEVGREEGRRLMEAEGCISCHSTDGSIIAGPTLKGLWNAPTTVLRDGKEQQATADEAYLR
AKIANAPSQGTVKGFDPMMPPYDHLTPEQLGAMVEYIKSLGEHSH