Protein Info for DvMF_0532 in Desulfovibrio vulgaris Miyazaki F

Annotation: UbiA prenyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 97 to 124 (28 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details PF01040: UbiA" amino acids 32 to 124 (93 residues), 54.9 bits, see alignment E=4e-19 amino acids 149 to 293 (145 residues), 61.5 bits, see alignment E=4e-21

Best Hits

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to dvm:DvMF_0532)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKR0 at UniProt or InterPro

Protein Sequence (346 amino acids)

>DvMF_0532 UbiA prenyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPSMHDLRLLLRLNVTLMVGAATAFGFLLAVPLPFGGAAALSGSNPAAALVWVVAGAMLL
AAACSAWNQAQERDIDALLPRTAGRPLPAGRMAPWTATGIGALLFVAALGCLHAAGELAA
SLAYLHAGKLPSDVVPGAGSPVLGAPVPGLSLLLVGAGIAAVYNGVYTPLKRVTSFALLP
GALVGAMPPLLGWMAAGGDPRDPVAILLYGVYVLWQVPHFWLRAQRECIHYVRAGLPVPP
AQFAAPRYARLLRVWYHAYAVAVLMLPVFPLLHAPLVRAGVVLLGVALLGVSALARTVRG
VEGDAAEVVVSDAGMTPRESLALRAADAAMPALMLLLLLDRMLPLF