Protein Info for DvMF_0527 in Desulfovibrio vulgaris Miyazaki F

Annotation: 1-(5-phosphoribosyl)-5-amino-4-imidazole- carboxylate (AIR) carboxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 174 to 194 (21 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details PF00731: AIRC" amino acids 121 to 246 (126 residues), 54 bits, see alignment E=7.1e-19

Best Hits

Swiss-Prot: 56% identical to LARB_LACPL: Pyridinium-3,5-biscarboxylic acid mononucleotide synthase (larB) from Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

KEGG orthology group: K06898, (no description) (inferred from 100% identity to dvm:DvMF_0527)

MetaCyc: 56% identical to pyridinium-3,5-biscarboxylic acid mononucleotide synthase (Lactiplantibacillus plantarum)
RXN-19042 [EC: 2.5.1.143]

Predicted SEED Role

"Circadian phase modifier" in subsystem Cyanobacterial Circadian Clock

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.143

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKQ5 at UniProt or InterPro

Protein Sequence (250 amino acids)

>DvMF_0527 1-(5-phosphoribosyl)-5-amino-4-imidazole- carboxylate (AIR) carboxylase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MDRTDALRDLLEGIRAGTIDVDKGMSQLRDLPYLEMGHTRFDMHRKLRNGFPEVVYGAGK
TPEQVAEIFTRLRGLSHVLATRVSPEMAAHVLAVCPEAAYNPLGRTLTMLHGELVFKPGE
IGIITAGTSDLPVAEEARVTCEMLGSRAWVISDVGVAGVHRLFDRLDELRKARVLIVVAG
MEGALTSVVGGLVSQPLIAVPTSVGYGANFAGLSALLGMLTSCASGITVVNIDNGFGAAC
AACRINNLFA