Protein Info for DvMF_0524 in Desulfovibrio vulgaris Miyazaki F

Annotation: nicotinate-nucleotide pyrophosphorylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 27 to 299 (273 residues), 255.5 bits, E=2.6e-80
• PF02749: QRPTase_N
  • amino acids 35 to 128 (94 residues), 46.3 bits, E=3.9e-16
• PF01729: QRPTase_C
  • amino acids 130 to 298 (169 residues), 167.5 bits, E=2.3e-53

Best Hits

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 100% identity to dvm:DvMF_0524)

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• aspartate superpathway (20/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD de novo biosynthesis II (from tryptophan) (4/9 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)
• superpathway of NAD biosynthesis in eukaryotes (4/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

See B8DKQ2 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DvMF_0524 nicotinate-nucleotide pyrophosphorylase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSSHTVPDFDTFFAGQPREHLLAAIDLALLEDGPDLTSDAVFGPVDRLAAQIVAKQQTLV
AGLPIAPLVMERCAALLESPVVGGWTWTPHTADGDELPSGFIAADIEGPARLVLKAERVI
LNFVCHLSGIANLTRRYTRELDGTSTRLLDTRKTLPGLRFPEKYAVLVGGGQNHRRTLAE
MLMLKDNHIDAAGSITAAVAALRAAYAPCPPIEVECRTLDEVREAVACTVDRIMLDNMDL
ALLRESLTVVPPGIETEASGGITLETLRQLAEASPHGPDFVSVGRLTHSAPVADFSMRIR
KA