Protein Info for DvMF_0489 in Desulfovibrio vulgaris Miyazaki F

Annotation: peptidyl-tRNA hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF01195: Pept_tRNA_hydro" amino acids 6 to 194 (189 residues), 201.6 bits, see alignment E=5e-64 TIGR00447: aminoacyl-tRNA hydrolase" amino acids 6 to 191 (186 residues), 181.9 bits, see alignment E=5e-58

Best Hits

Swiss-Prot: 100% identical to PTH_DESVM: Peptidyl-tRNA hydrolase (pth) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K01056, peptidyl-tRNA hydrolase, PTH1 family [EC: 3.1.1.29] (inferred from 100% identity to dvm:DvMF_0489)

Predicted SEED Role

"Peptidyl-tRNA hydrolase (EC 3.1.1.29)" (EC 3.1.1.29)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKL7 at UniProt or InterPro

Protein Sequence (202 amino acids)

>DvMF_0489 peptidyl-tRNA hydrolase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MNVAGLIVGLGNPGKEYERTRHNLGFMAVDALMEAAARETGGGCDQLSGGKKKYDLWRCR
ITPTGDPWLVAKPQTFMNLSGEAVLAIASYYRIKPDAILVVHDELDIPLGRMKFKTGGGN
AGHNGLKSITQLLGTPDFHRLRLGIGRSPHGGETTNWVLGRLSGPEQTLLDTLLPAAVQA
MTIFASQGAAAATQFANAYKPD