Protein Info for DvMF_0486 in Desulfovibrio vulgaris Miyazaki F

Annotation: 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 287 to 302 (16 residues), see Phobius details TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase" amino acids 13 to 315 (303 residues), 151.8 bits, see alignment E=1.5e-48 PF00288: GHMP_kinases_N" amino acids 96 to 158 (63 residues), 43.5 bits, see alignment E=3.5e-15 PF08544: GHMP_kinases_C" amino acids 258 to 319 (62 residues), 38.8 bits, see alignment E=9.8e-14

Best Hits

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 100% identity to dvm:DvMF_0486)

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKL4 at UniProt or InterPro

Protein Sequence (329 amino acids)

>DvMF_0486 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSTHATPAPGVVTLHAGCKVNLYLRITGVRPDGYHELDTLFLPLPEPCDLLHVSPRAEAG
IVFTCTEPDVDPARNTVVTAYERFAAATGFRPGLAVHLEKHIPHGAGLGGGSADAAVLLR
HLAALCAQQAPGAAPTPEALRAMAAGVGADVPFFLMDGPARASGIGVVLTPLAPGELADL
GLAGMHLVLACPPVRVSTPWAYRAWDAANVTTPDDNAQTSTRTSAQNSARMMTGQSAKSL
RPCLTSESLEDRNPLSRGPWLTNSFEPVVFQTHATLRRTKEFLLRRGGCAALMSGSGASL
FALFRKHGTARDVAEALRNDNIAAFLHAL