Protein Info for DvMF_0485 in Desulfovibrio vulgaris Miyazaki F

Annotation: ATP-dependent protease peptidase subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00227: Proteasome
  • amino acids 4 to 176 (173 residues), 105.9 bits, E=1.1e-34
• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 6 to 177 (172 residues), 278.2 bits, E=1.1e-87

Best Hits

Swiss-Prot: 100% identical to HSLV_DESVM: ATP-dependent protease subunit HslV (hslV) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 100% identity to dvm:DvMF_0485)

MetaCyc: 58% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

See B8DKL3 at UniProt or InterPro

Protein Sequence (185 amino acids)

>DvMF_0485 ATP-dependent protease peptidase subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MELKGTTILAVRDADGVAMAGDGQVTMGQSVVMKHTARKVRRLYRDRVLAGFAGATADAF
TLFERFEAKLEEFGGNLTRAAVELAKDWRKDKYLRRLEAMLLVADAETILILTGTGDVIE
PDDGIAAIGSGGPYALSAARALSRHTTLDAETVVREAMAVAGELCVFTNGHLTVETLRRN
GGATT