Protein Info for DvMF_0482 in Desulfovibrio vulgaris Miyazaki F

Name: cysS
Annotation: cysteinyl-tRNA synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 TIGR00435: cysteine--tRNA ligase" amino acids 1 to 482 (482 residues), 539.6 bits, see alignment E=4.1e-166 PF01406: tRNA-synt_1e" amino acids 14 to 312 (299 residues), 440.4 bits, see alignment E=9.5e-136 PF09334: tRNA-synt_1g" amino acids 35 to 108 (74 residues), 34.5 bits, see alignment E=2.5e-12 amino acids 242 to 322 (81 residues), 28.9 bits, see alignment E=1.3e-10 PF09190: DALR_2" amino acids 353 to 422 (70 residues), 49.8 bits, see alignment E=1e-16

Best Hits

Swiss-Prot: 100% identical to SYC_DESVM: Cysteine--tRNA ligase (cysS) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 100% identity to dvm:DvMF_0482)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKL0 at UniProt or InterPro

Protein Sequence (485 amino acids)

>DvMF_0482 cysteinyl-tRNA synthetase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MQLYNTLTRKKEHFEPAVPGKVNMYVCGITAYDLCHIGHARSAVVFDVLVRYLRHTGLDV
TFARNFTDVDDKIITRANQEGLTSQEVAEKYIATFYEDMDRLNVLRADLEPRATTHIEEM
ISLCVRLIEQDKAYATPSGDVYFRVRAFPGYGKLSGRDVDDLRSGARVAPGEEKEDPLDF
ALWKAAKPGEPFWESPWGNGRPGWHIECSAMSEKHLPLPLDIHGGGQDLVFPHHENEIAQ
TEAALGKDFVRYWVHNGFVQVNAEKMSKSLGNFRTIRDILENYLPETLRYFLLTKHYRSP
IDFTFESMDEAEKNLKRIYEALGLLHAELEREKWTSGPLPKDVTEEFEGLRQAFADAMED
DMNTAAALGHVFTMVRLANRILDNKGQRKTEGARAFFRAVLDEAATWFAVLGVFGREPAG
FLAELRACRVARKGIDPAKVEELLQARINARADKDFARADAIRDEIAALGIEVRDTPSGA
VWDVL