Protein Info for DvMF_0475 in Desulfovibrio vulgaris Miyazaki F

Annotation: alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF08534: Redoxin" amino acids 24 to 139 (116 residues), 45.7 bits, see alignment E=1.5e-15 PF00578: AhpC-TSA" amino acids 38 to 134 (97 residues), 55.1 bits, see alignment E=1.8e-18 PF13098: Thioredoxin_2" amino acids 40 to 151 (112 residues), 41.4 bits, see alignment E=4.3e-14 PF00085: Thioredoxin" amino acids 43 to 91 (49 residues), 25.4 bits, see alignment E=2.9e-09 PF13905: Thioredoxin_8" amino acids 44 to 132 (89 residues), 49.1 bits, see alignment E=1.5e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0475)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKK3 at UniProt or InterPro

Protein Sequence (157 amino acids)

>DvMF_0475 alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKRLTSLMLLPLLLVALCGVAAAAPAVEEMGSGELLRRVTAARGKVVIVNFFASWCPPCL
EEIPGLINVRARYSEDKVALYGISLDENPRQLAAFMSRTPFNYPVWKGKEELQRFFNVSS
IPQLLVYDRQGKLVANHVGLVEADELGKFVDTLLGGN