Protein Info for DvMF_0473 in Desulfovibrio vulgaris Miyazaki F

Annotation: hypoxanthine phosphoribosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 9 to 159 (151 residues), 99 bits, E=8.7e-33
• TIGR01203: hypoxanthine phosphoribosyltransferase
  • amino acids 9 to 170 (162 residues), 189.2 bits, E=2.3e-60

Best Hits

Swiss-Prot: 42% identical to HPRT_STRT2: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 100% identity to dvm:DvMF_0473)

MetaCyc: 43% identical to hypoxanthine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Hypoxanthine phosphoribosyltransferase. [EC: 2.4.2.8]; 2.4.2.8 [EC: 2.4.2.8]

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• adenine and adenosine salvage III (3/4 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)
• guanine and guanosine salvage II (1/2 steps found)
• adenine salvage (1/3 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

See B8DKK1 at UniProt or InterPro

Protein Sequence (179 amino acids)

>DvMF_0473 hypoxanthine phosphoribosyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKIKDLKVVYDAQAIATRVAEMGQEINRLYAGEELVVVCVLKGAFMFFADLVRHLDMRPE
LDFVRVASYGSSTSTCGTVSFTKDVEVPLQGKHVLLVEDIVDTGHTVDFLFRQLAARGAK
SLRLAALVDKQERRAVPVRVDFAGFALPGGFIVGYGLDYAERYRELPGIYEAVIEPEGA