Protein Info for DvMF_0471 in Desulfovibrio vulgaris Miyazaki F

Annotation: DNA repair protein RadA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 TIGR00416: DNA repair protein RadA" amino acids 2 to 431 (430 residues), 460.2 bits, see alignment E=3.7e-142 PF18073: Zn_ribbon_LapB" amino acids 7 to 33 (27 residues), 45.1 bits, see alignment (E = 9.1e-16) PF06745: ATPase" amino acids 74 to 279 (206 residues), 45 bits, see alignment E=1.3e-15 PF13481: AAA_25" amino acids 83 to 223 (141 residues), 46.4 bits, see alignment E=5.4e-16

Best Hits

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 100% identity to dvm:DvMF_0471)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKJ9 at UniProt or InterPro

Protein Sequence (492 amino acids)

>DvMF_0471 DNA repair protein RadA (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKLRETYVCTACGARAPQWRGQCPACKEWNTLELTVAPREGKAGARPGASSVGAQSRAQP
LKDVADHGAEPFGSGLDALDRVLGKGLVPGAAILVGGEPGIGKSTLLLQVAGAVAAAGRG
VLYLSGEESLPQLKARAARLGVLHDELMAVATTRLDDVLPHLEGPEAPALLIVDSVQTVS
SDRAEGLPGNVSQVRAVSTEIVEACKRSGTTVLLVGHVTKDGALAGPRLLEHLVDTVISI
EGDRRQMFRLLRVLKNRFGPNQELLVFRMVEQGMEVVEDPSTFFLGARDPALSGTALVMA
VDGQRPLAVEVQALVTRSYLAIPRRTGLGFDVNRLHLLLAVLEKRLRLNFGQVDIYAKIG
GGMKLQDPGMDLGLVAAVLSSFYDLPLPERAVFWGEVDLNGQVRPVAAHTIRRDQARRLG
YTPILHPADDAARGVPTVAALQDALFRRARRPSYTDPAGNGPRAQGGGTPSGFGGPADTA
DSGSDYGGHDDV