Protein Info for DvMF_0458 in Desulfovibrio vulgaris Miyazaki F

Annotation: ATP-dependent Clp protease, ATP-binding subunit clpA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 816 PF02861: Clp_N" amino acids 4 to 126 (123 residues), 70.1 bits, see alignment E=1.2e-22 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 4 to 740 (737 residues), 1100.9 bits, see alignment E=0 PF00004: AAA" amino acids 210 to 342 (133 residues), 47 bits, see alignment E=1.9e-15 amino acids 495 to 615 (121 residues), 44.5 bits, see alignment E=1.2e-14 PF17871: AAA_lid_9" amino acids 349 to 449 (101 residues), 96.4 bits, see alignment E=4.8e-31 PF07724: AAA_2" amino acids 489 to 652 (164 residues), 199 bits, see alignment E=3.1e-62 PF07728: AAA_5" amino acids 494 to 612 (119 residues), 53.6 bits, see alignment E=1.3e-17 PF10431: ClpB_D2-small" amino acids 659 to 738 (80 residues), 81.6 bits, see alignment E=1.9e-26

Best Hits

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 100% identity to dvm:DvMF_0458)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJU3 at UniProt or InterPro

Protein Sequence (816 amino acids)

>DvMF_0458 ATP-dependent Clp protease, ATP-binding subunit clpA (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MIGRRLEAALTAAVNDVRTRNHEFLTLEHLLYAITGEDAGKHILEAVGVDVKSLRLRLET
FFATHLEPLPADTPTEVVQTLGVQRVLQRAIRHMQSAGKGAVEIGDVLAAIFEEDDAYAT
YFLKSQGVTRLDVLQHISHGAPQGGDVDGGDDAEGEDGAPDTPRIDALEKFTVDLTARAR
DGRIDPLIGRVKELERTIQVLARRRKNNPLYVGDPGVGKTAIAEGLALRVAGGDVPEEFR
DVRIFALDMGALLAGTKYRGDFEQRLKGVITDLGKVPGAILFIDEIHTIVGAGSTSGGSM
DASNILKPVLADGSIRCIGSTTYEEYRNHFEKDRALSRRFQKIDVQEPSQDECVDILKGL
RPYYEDHHKVRYTLPALRAAVELSARYITERLLPDKAIDVLDEAGAAARLRRGARAASAS
DAAIGVKEVEKVVARMAQIPSRTVSSSDRDRLRTLDEDLRNVVFGQDAAVGILSRAILRA
RAGLGREDRPTGSFLFYGPTGVGKTELARRLAEVMGIGFLRYDMSEYMEKHSVSRLIGAP
PGYVGFDQGGLLTEAIRKQPYTVLLLDEIEKAHPDIFNILLQVMDYATLTDNTGRKADFR
NVVLIMTSNAGVREMSAPAIGFGATAQEDMAGKGRKAVENMFSPEFRNRLDAMIPFAGLT
TPVMERIVDKFVLELGSGLKDRRVRLELTPAARARLAEKGFEPAFGARPLRRVIRTALED
ELAREVLFGKLRKGGTAIVDVAAPEAAAAPARPARKGKGKAAARDGAPSAVSADVAKAAP
TVPATVGPSADQQGIAGLGLVFRYEPLGGDEAATDK