Protein Info for DvMF_0437 in Desulfovibrio vulgaris Miyazaki F

Annotation: magnesium-translocating P-type ATPase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 880 transmembrane" amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 297 to 322 (26 residues), see Phobius details amino acids 751 to 773 (23 residues), see Phobius details amino acids 785 to 804 (20 residues), see Phobius details amino acids 816 to 836 (21 residues), see Phobius details amino acids 851 to 874 (24 residues), see Phobius details TIGR01524: magnesium-translocating P-type ATPase" amino acids 29 to 877 (849 residues), 1124.7 bits, see alignment E=0 PF00690: Cation_ATPase_N" amino acids 39 to 99 (61 residues), 44.7 bits, see alignment 2.1e-15 TIGR01494: HAD ATPase, P-type, family IC" amino acids 113 to 369 (257 residues), 110.7 bits, see alignment E=6.1e-36 amino acids 592 to 711 (120 residues), 98.4 bits, see alignment E=3.4e-32 PF00122: E1-E2_ATPase" amino acids 139 to 252 (114 residues), 85.7 bits, see alignment E=4.3e-28 PF00702: Hydrolase" amino acids 348 to 636 (289 residues), 48.2 bits, see alignment E=4.4e-16 PF13246: Cation_ATPase" amino acids 414 to 532 (119 residues), 88.4 bits, see alignment E=1.3e-28 PF00689: Cation_ATPase_C" amino acids 706 to 873 (168 residues), 65.3 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K01531, Mg2+-importing ATPase [EC: 3.6.3.2] (inferred from 100% identity to dvm:DvMF_0437)

Predicted SEED Role

"Mg(2+) transport ATPase, P-type (EC 3.6.3.2)" (EC 3.6.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJS2 at UniProt or InterPro

Protein Sequence (880 amino acids)

>DvMF_0437 magnesium-translocating P-type ATPase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRRGHASVIPRDMARLRASATGIQVPSELVDASGSEIPTLLARLKTTPHGLAQGEAERRL
RLHGVNAVGTDRSHPRLRMLAKALLNPLVILLLVLAALSALTGDMRAATVMGLMVVLGVG
LRFVQEARADTAAARLRTMISVTATVERDGTTREIPLAHVVPGEIVHLAAGDMIPADVRL
ISSKDLYVIQASLTGESLPAEKFDHMEDGAGRSPLELRNICFLGTSVGSGTATAVVVSTG
GATYLGNMANAITDAPPPTSFDKGVTRFTWLMIRFIAIMVPLVFVINGLTKHDWHQAFFF
AMAVAVGLTPEMLPMIATVCLSKGALAMSRKRVIVKRLNAIQNLGAMDILCTDKTGTLTM
DKVVLKLHLDVRLDEDEAVLALAYTNSHFQTGLKNGLDRAVLSHHELHQDQGISEFRKLD
EIPFDFQRKIMSVVVETPDHVVRLIAKGACEEIFQRCTLCEFGGTTVPLDQALRATVHAA
YGKLSADGFRVLALAYRDIAVAVAGAGPAFSKKDEADLTLRGFIAFLDPPKETTAPAIQA
IKALGVSLKVLTGDNDMVSRKICRDVGVPTEHVLTGAEIEAMDDAELASRVEQVTLFARL
SPAHKQRIISALRGRGHVVGFMGDGINDAPALREADVGVSVDTAVDIAKEAADVVLLEKS
LMVLEQGIIEGRKVFANILKYVRMSASSNFGNMFSVLGASTFLPYVPMLPIQVLLNNLLY
DVSQVPIPTDEVDAEQLAAPRPWALDRITRFILFFGPCSSLFDYATFGVMLYAFDCWAPD
KAALFQTGWFVESILTQTLIIHVIRTSRIPFVQSRASLPLILTTTSIMAFGMWLPYSPMA
DALGMVELPPLYWPLLAGMSLGYVLLTQGVKMLLLRKRWI