Protein Info for DvMF_0409 in Desulfovibrio vulgaris Miyazaki F

Annotation: CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 82 to 107 (26 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 12 to 186 (175 residues), 163.6 bits, see alignment E=3.5e-52 PF01066: CDP-OH_P_transf" amino acids 12 to 173 (162 residues), 146.5 bits, see alignment E=4.5e-47

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 100% identity to dvm:DvMF_0409)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJP4 at UniProt or InterPro

Protein Sequence (195 amino acids)

>DvMF_0409 CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTQQQSPFQRMFNLANRITLARIFIVPAIVVLLMFPGRITCLAAVVLFALASITDVIDGH
IARRSNMVTSFGKFLDPLADKILIGSVLIMLVELGWIAGWIAIVIIARELMVTGLRAVAA
DEGLVIAADKFGKMKTVMQMFALVPLMLHFPWFGLDPNPAGQFMLYIALFLTVFSGFNYL
YTFYGNWLKEGAGRA