Protein Info for DvMF_0396 in Desulfovibrio vulgaris Miyazaki F

Annotation: iron-sulfur cluster binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00273: iron-sulfur cluster-binding protein
  • amino acids 17 to 456 (440 residues), 486.4 bits, E=3.8e-150
• PF02589: LUD_dom
  • amino acids 68 to 293 (226 residues), 169.7 bits, E=2.3e-53
• PF13183: Fer4_8
  • amino acids 310 to 376 (67 residues), 44.2 bits, E=8.3e-15
• PF13534: Fer4_17
  • amino acids 311 to 376 (66 residues), 25.4 bits, E=5.9e-09
• PF11870: LutB_C
  • amino acids 384 to 471 (88 residues), 85.6 bits, E=8.9e-28

Best Hits

Swiss-Prot: 42% identical to LUTB_BACVZ: Lactate utilization protein B (lutB) from Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0396)

MetaCyc: 42% identical to component of an iron-sulfur oxidase linked to L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• Bifidobacterium shunt (13/15 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See B8DJN1 at UniProt or InterPro

Protein Sequence (475 amino acids)

>DvMF_0396 iron-sulfur cluster binding protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MGSQHLDFTANVTEALADRQLRANFKSALTGLMKKRVAVLPDAAERERMRDDAEAAKRKA
LAKLPELLERLERKCTENGIIVHWAETTAEANEIILDIMRSHDATRLVKGKSMVSEEMHL
NHFLETHGIEALETDLGEFIIQLNHEPPSHIIVPAVHKNRQQVGRIFADNLQGIPYTDVV
EELNAIARKTLREKFRTGHVGLSGVNFAVAETGTLVLVENEGNGRMCTTVPPVHVAVMGL
EKVVESLSDLPPLLRLLTASATGQLVTTYVNCITSPRKDGERDGPKEIHLVILDNGRSRM
LADAQLRRTLQCIRCGTCLNHCPVYIRIGGHAYGSVYPGPIGKILTPQIDGLADKGVLAT
ASSLCNACEEVCPVRIPIPGIIRRMRTEAYDEKGDGVVKGHGAKKNLLETLVWKGWELTY
RIPALNRFVVSMLGRFGDKLPNVGPLKAWTSVRTAPRFAPKSLHQLAKEEGIRHE