Protein Info for DvMF_0364 in Desulfovibrio vulgaris Miyazaki F

Annotation: putative translaldolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR00875: fructose-6-phosphate aldolase" amino acids 1 to 214 (214 residues), 280 bits, see alignment E=5.2e-88 PF00923: TAL_FSA" amino acids 3 to 213 (211 residues), 179 bits, see alignment E=7.1e-57

Best Hits

Swiss-Prot: 62% identical to TAL_DESAD: Probable transaldolase (tal) from Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to dvm:DvMF_0364)

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.2

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJJ9 at UniProt or InterPro

Protein Sequence (217 amino acids)

>DvMF_0364 putative translaldolase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MQFFLDTANLAEMRAAKAWGLLDGVTTNPTLMAREGGDWRMVMQAICREVEGPVSLEAVG
DTADELITMGLDLVRNGPNVVVKIPMTPEGLKAVRVLKTKGVDTNVTLVFSPMQALLAAK
AGASFISPFVGRLDGLSQDGMQLVADIMTILRNYSGMGMDARVIVASVRHPRHVAEAALM
GAHVATVPFAVLRQMFDHPLTTSGLETFNKDWAALNG