Protein Info for DvMF_0361 in Desulfovibrio vulgaris Miyazaki F

Annotation: LL-diaminopimelate aminotransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR03540: LL-diaminopimelate aminotransferase" amino acids 5 to 388 (384 residues), 623.2 bits, see alignment E=8.1e-192 PF00155: Aminotran_1_2" amino acids 34 to 386 (353 residues), 233.1 bits, see alignment E=3e-73

Best Hits

Swiss-Prot: 100% identical to DAPAT_DESVM: LL-diaminopimelate aminotransferase (dapL) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K10206, LL-diaminopimelate aminotransferase [EC: 2.6.1.83] (inferred from 100% identity to dvm:DvMF_0361)

MetaCyc: 39% identical to glutamate--pyruvate aminotransferase AlaC (Escherichia coli K-12 substr. MG1655)
Alanine transaminase. [EC: 2.6.1.2]

Predicted SEED Role

"L,L-diaminopimelate aminotransferase (EC 2.6.1.83)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.6.1.83)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.2 or 2.6.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJJ6 at UniProt or InterPro

Protein Sequence (389 amino acids)

>DvMF_0361 LL-diaminopimelate aminotransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MADFKLADRLATLPPYLFAGIDKVKAEVAARGVDIISLGIGDPDMPTPDFIIEAMKKAVE
RPANHQYPSYVGMLEFRQEVANWYGRRFGVSLDPKTEVIGLIGSKEGIAHFPLAFVNPGD
LVLVCTPNYPVYHIATGFVGGEVQFIPLVEENDYLPDLDAIPAATWDRAKMIFVNYPNNP
TAATAPRAFYEKLIGICRKHNVIIAHDTAYTEVYYDENDKPMSILEVEGAKDVTIEFHSL
SKTYNMTGWRVGMAVGNASLVAGLGKVKENVDSGIFQAVQEASIVALRDGDDFCRELRGI
YRKRRDVVVAALNKVGIACRVPTAAFYIWAKVPAGYGSSAEFVTAVLEKTGVVLTPGNGF
GTPGEGYFRISLTVDTDRLEEAVSRIANL