Protein Info for DvMF_0357 in Desulfovibrio vulgaris Miyazaki F

Annotation: histidine triad (HIT) protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 172 to 191 (20 residues), see Phobius details amino acids 215 to 240 (26 residues), see Phobius details PF04677: CwfJ_C_1" amino acids 17 to 92 (76 residues), 28.3 bits, see alignment E=2.8e-10 PF11969: DcpS_C" amino acids 20 to 123 (104 residues), 25.2 bits, see alignment E=4e-09 PF01230: HIT" amino acids 36 to 125 (90 residues), 49.7 bits, see alignment E=9.9e-17 PF06305: LapA_dom" amino acids 205 to 264 (60 residues), 36.8 bits, see alignment E=5.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0357)

Predicted SEED Role

"HIT family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJJ2 at UniProt or InterPro

Protein Sequence (298 amino acids)

>DvMF_0357 histidine triad (HIT) protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
METLWAPWRLDYILGPKPDSCVFCLPEHTEEDEARLVLYRGRHNFVIMNKFPYNNGHLMV
TPFRHVMDLAALEPDEAHEMMDLLQTCTTMLRQRFNPQGINVGLNLGEAAGAGIREHLHF
HLVPRWNGDSSFMAVMSETRVIPEHLHSTYHALKPCSTACPARDGKEADMRFVKVLVLVL
VFFISMMFFVQNNAVLSQTVTLKLDLFFDTAWSSIALPFYFMVLCAFLMGALLTMLLLMI
SRMRAGAALRRANKRIRVLEKELNSLRNLPLETARKTPEPVAAPAPVAATDPTPAKAG